Recombinant Proteins
Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
Recombinant
- (285)
- (11)
- (65,867)
- (1)
For Use With (Application)
- (2)
- (970)
- (1)
- (23,540)
- (5)
- (1)
- (1)
- (67)
- (216)
- (4,420)
- (23)
- (1)
- (4)
- (2)
- (13)
- (21,448)
- (3)
- (4)
- (3)
- (1)
- (2)
- (4)
- (14)
- (71)
- (2)
- (2)
- (2)
- (1)
- (3)
- (2)
- (1)
- (157)
- (3)
- (4)
- (1)
- (1)
- (1)
- (3)
- (253)
- (22,591)
- (1)
- (1)
- (2)
- (1)
- (13)
- (26,799)
- (253)
- (32)
- (3)
- (708)
- (14)
- (2)
- (1)
- (8)
- (1)
- (5)
- (1)
- (105)
- (1)
- (3,750)
- (1,407)
- (3)
- (4)
- (5)
- (1)
- (1)
- (1)
- (1)
- (14)
- (138)
- (48)
- (6)
- (17)
- (2)
- (1)
- (10)
- (4)
- (81)
- (12)
- (2)
- (3)
- (80)
- (4)
- (113)
- (96)
- (19)
- (1)
- (1)
- (4)
- (1)
- (1,522)
- (2)
- (1)
- (160)
- (18)
- (48)
- (3)
- (3)
- (1)
- (2)
- (9)
- (27)
- (2)
- (208)
- (1)
- (4)
- (1)
- (2)
- (114)
- (44)
- (2)
- (1)
- (1)
- (4)
- (1)
- (1)
- (3)
- (1)
- (23,708)
- (6)
- (3)
- (1)
- (1)
- (63)
- (6)
- (2)
- (7)
- (5)
- (1)
- (2)
- (1)
- (1)
- (6,758)
- (6)
- (4)
- (1)
- (3)
- (1)
- (3)
- (2)
- (13)
- (17)
- (1)
- (3)
- (3)
- (4)
- (27,095)
- (235)
- (1)
- (3)
Species
- (2)
- (1)
- (2)
- (1)
- (89)
- (559)
- (96)
- (2)
- (1)
- (1)
- (2)
- (1)
- (27)
- (1)
- (8)
- (15)
- (1)
- (72)
- (1)
- (1,303)
- (1)
- (3)
- (16)
- (1)
- (3)
- (1)
- (1)
- (1)
- (8)
- (1)
- (4)
- (1)
- (1)
- (29,092)
- (5)
- (22)
- (8)
- (4)
- (1,291)
- (2)
- (1)
- (1)
- (3)
- (1)
- (1)
- (8)
- (14)
- (32)
- (24)
- (1)
- (2)
- (16)
- (233)
- (9)
- (2)
- (5)
- (1)
- (2)
- (2)
- (2)
- (23)
- (5)
- (3)
- (3)
- (2)
- (14)
- (23,574)
- (1)
- (48)
Form
- (15)
- (1)
- (2)
- (45,208)
- (5,648)
- (245)
- (168)
- (56)
- (3,361)
Conjugate
- (7)
- (1)
- (3)
- (18)
- (2)
- (62)
- (1)
- (4)
- (2)
- (9)
- (59)
- (1)
- (2)
- (3)
- (1)
- (391)
- (1)
- (3)
- (2)
- (1)
- (1)
- (1)
- (3)
- (2)
- (3)
- (19)
- (7)
- (2)
- (2)
- (3)
- (45)
- (1)
- (1)
- (1)
- (2)
- (5)
- (1)
- (1)
- (1)
- (2)
- (8)
- (2)
- (3)
- (43,090)
- (1)
- (11)
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
Search Within Results
Keyword Search:
Clear All
466
–
480
of
119,908
results
466
Invitrogen™ Human Asporin (aa 165-287) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | Asporin |
| Gene Symbol | Aspn |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | IPLNLPKSLAELRIHENKVKKIQKDTFKGMNALHVLEMSANPLDNNGIEPGAFEGVTVFHIRIAEAKLTSVPKGLPPTLLELHLDYNKISTVELEDFKRYKELQRLGLGNNKITDIENGSLAN |
| Concentration | 2.8 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human Asporin (aa 165-287) Control Fragment |
| Accession Number | Q9BXN1 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | 4631401G09Rik; AA986886; ASPN; Asporin; asporin (LRR class 1); asporin proteoglycan; FLJ20129; OS3; periodontal ligament associated protein 1; periodontal ligament-associated protein 1; PLAP1; PLAP-1; SLRR1C; small leucine-rich protein 1C; UNQ215/PRO241 |
| Product Type | Protein |
| Gene ID (Entrez) | 54829 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |
467
Invitrogen™ Human Lck, His Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Conjugate | Unconjugated |
|---|---|
| Form | Liquid |
| pH Range | 7.5 |
| Common Name | LCK |
| Molecular Weight (g/mol) | 60.6 kDa |
| Gene Symbol | LCK |
| Concentration | See Label |
| Expression System | Insect cells |
| For Use With (Application) | Kinase Assay |
| Accession Number | P06239 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | EC 2.7.10.2; Hck-3; IMD22; kinase Lck; Lck; LCK proto-oncogene, Src family tyrosine kinase; Lck1; Lcktkr; leukocyte C-terminal Src kinase; LSK; Lskt; Lsk-t; Lymphocyte cell-specific protein-tyrosine kinase; lymphocyte protein tyrosine kinase; lymphocyte-specific protein tyrosine kinase; OTTHUMP00000008640; OTTHUMP00000008740; OTTHUMP00000008741; p56(LSTRA) protein-tyrosine kinase; p56>lck>; p56lck; p56-LCK; pp58lck; Protein YT16; Proto-oncogene Lck; Proto-oncogene tyrosine-protein kinase LCK; RP4-675E8.4; t cell-specific protein-tyrosine kinase; T-lymphocyte specific protein tyrosine kinase p56lck; tyr; tyrosine-protein kinase Lck; YT16 |
| Product Type | Protein |
| Gene ID (Entrez) | 3932 |
| Protein Tag | His-tag |
| Species | Human |
| Recombinant | Recombinant |
468
Invitrogen™ Human GSK-3B (GSK3 beta), His Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | RUO - research use only |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| Molecular Weight (g/mol) | 53.1 kDa |
| Formulation | 50 mM tris with 0.01% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5 |
| Sequence | Full length |
| Concentration | See Label |
| For Use With (Application) | Kinase Assay |
| Name | Human GSK-3 B (GSK3 beta), His Tag |
| Recombinant | Recombinant |
469
Invitrogen™ Human MLCK (MLCK2), GST Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Protein Family | Kinases & Inhibitors |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| pH Range | 7.5 |
| Common Name | MLCK |
| Molecular Weight (g/mol) | 113.6 kDa |
| KinaseFamily | MLCK Kinase Family |
| Kinase Group | Ser⁄Thr Kinases: CAMK Group |
| Expression System | Baculovirus |
| For Use With (Application) | Kinase Assay |
| Name | Human MLCK (MLCK2), GST Tag |
| Purification Method | Purified |
| Gene Alias | caMLCK; cardiac MLCK; cardiac-MLCK; cardiac-MyBP-C associated Ca/CaM kinase; cardiac-MyBP-C-associated Ca/CaM kinase; cardiac-specific myosin light chain kinase; D830007F02Rik; MLC kinase; MLCK; MLCK2; Mylk3; Myosin light chain kinase 3; putative myosin light chain kinase 3; putative myosin light chain kinase 3; myosin light chain kinase 3; RGD1305801 |
| Protein Form | Recombinant, Full Length |
| Formulation | 50mM tris with 0.5mM EDTA, 2mM DTT, 50% glycerol, 150mM NaCl, 0.02% Triton X-100 and no preservative; pH 7.5 |
| Recombinant | Recombinant |
| Shipping Condition | Dry Ice |
| Content And Storage | -80°C, Avoid Freeze/Thaw Cycles |
| Gene Symbol | MYLK3 |
| Sequence | Full length |
| Storage Requirements | -80°C, Avoid Freeze/Thaw Cycles |
| Concentration | See Label |
| Protein Subtype | Serine/Threonine Kinases |
| Accession Number | Q32MK0 |
| Regulatory Status | RUO |
| Product Type | Protein |
| Gene ID (Entrez) | 91807 |
| Protein Tag | GST-tag |
470
Invitrogen™ Human ZAP-70, His Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | -20°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| Common Name | Zap-70 |
| Molecular Weight (g/mol) | 70.1 kDa |
| KinaseFamily | SYK Kinase Family |
| Sequence | Full length |
| Concentration | See Label |
| Expression System | Baculovirus |
| For Use With (Application) | Kinase Assay |
| Name | Human ZAP-70, His Tag |
| Accession Number | P43403 |
| Gene ID (Entrez) | 7535 |
| Protein Tag | His-tag |
| Species | Human |
| Recombinant | Recombinant |
471
Invitrogen™ Human MAP4K1 (HPK1), GST Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Protein Family | Kinases & Inhibitors |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| pH Range | 7.5 |
| Common Name | HPK1 |
| Molecular Weight (g/mol) | 65 kDa |
| Kinase Group | Serine/Threonine Kinase |
| Expression System | Baculovirus |
| For Use With (Application) | Kinase Assay |
| Name | Human MAP4K1 (HPK1), GST Tag |
| Purification Method | Purified |
| Gene Alias | EC 2.7.11.1; Hematopoietic progenitor kinase; hematopoietic progenitor kinase 1; HPK; HPK1; MAP4K1; MAPK/ERK kinase kinase kinase 1; MEK kinase kinase 1; MEKKK 1; mHPK1; mitogen activated protein kinase kinase kinase kinase 1; mitogen-activated protein kinase kinase kinase kinase 1 |
| Protein Form | Recombinant, Full Length |
| Formulation | 50mM tris HCl with 0.25mM DTT, 0.1mM EDTA, 10mM glutathione, 0.1mM PMSF, 25% glycerol, 150mM NaCl and no preservative; pH 7.5 |
| Species | Human |
| Recombinant | Recombinant |
| Content And Storage | -80°C, Avoid Freeze/Thaw Cycles |
| Gene Symbol | MAP4K1 |
| Sequence | 1-346 |
| Storage Requirements | -80°C, Avoid Freeze/Thaw Cycles |
| Concentration | See Label |
| Accession Number | Q92918 |
| Regulatory Status | RUO |
| Product Type | Protein |
| Protein Length | 1-346 |
| Gene ID (Entrez) | 11184 |
| Protein Tag | GST-tag |
472
Invitrogen™ Human CDK2/cyclin E1, GST Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Content And Storage | -80°C, Avoid Freeze/Thaw Cycles |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| Common Name | CDK2 |
| Molecular Weight (g/mol) | 60.2-73.4 kDa |
| Concentration | See Label |
| Expression System | Baculovirus |
| For Use With (Application) | Kinase Assay |
| Name | Human CDK2/cyclin E1, GST Tag |
| Accession Number | P24941 |
| Gene Alias | A630093N05Rik; CDC28; CDC2A; cdc2-related protein kinase; CDK1; CDK2; CDKN2; Cell division protein kinase 2; cyclin dependent kinase 2; cyclin dependent kinase 2-alpha; cyclin-dependent kinase 2; EC 2.7.11.22; EC 2.7.11.23; kinase Cdc2; MPF; p33 protein kinase; p33(CDK2); p33CDK2; p34 protein kinase |
| Protein Length | 1-298 |
| Gene ID (Entrez) | 1017 |
| Formulation | 50 mM tris HCl with 0.1 mM EDTA, 0.1 mM PMSF, 0.25 mM DTT, 10 mM glutathione, 150 mM NaCl, 25% glycerol and no preservative; pH 7.5 |
| Protein Tag | GST-tag |
| Species | Human |
| Recombinant | Recombinant |
473
Invitrogen™ Human CDK4/cyclin D3, GST Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Conjugate | Unconjugated |
|---|---|
| Form | Liquid |
| pH Range | 7.5 |
| Common Name | CDK4/Cyclin D3 |
| Molecular Weight (g/mol) | 60.0-58.8 kDa |
| KinaseFamily | CDKs and CHKs |
| Expression System | Insect cells |
| For Use With (Application) | Kinase Assay |
| Name | Human CDK4/cyclin D3, GST Tag |
| Purification Method | Purified |
| Gene Alias | Cdk4; Cell division protein kinase 4; CMM3; Crk3; cyclin dependent kinase 4; cyclin-dependent kinase 4; MGC14458; PSK-J3; serine/threonine kinase; Unknown (protein for MGC:133903) |
| Protein Form | Full Length, Recombinant, Active |
| Formulation | 50mM tris HCl with 0.1mM PMSF, 150mM NaCl, 0.1mM EDTA, 0.25mM DTT, 25% glycerol, 10mM glutathione and no preservative; pH 7.5 |
| Species | Human |
| Recombinant | Recombinant |
| Shipping Condition | Dry Ice |
| Content And Storage | -80°C, Avoid Freeze/Thaw Cycles |
| Gene Symbol | CCND3, CDK4 |
| Sequence | CDK4: 1-303, Cyclin D3: 1-292 |
| Storage Requirements | -80°C, Avoid Freeze/Thaw Cycles |
| Concentration | See Label |
| Accession Number | P11802, P30281 |
| Regulatory Status | RUO |
| Product Type | Protein |
| Gene ID (Entrez) | 1019, 896 |
| Protein Tag | GST-tag |
474
Invitrogen™ Human uPAR (aa 51-156) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | VRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGE |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human uPAR (aa 51-156) Control Fragment |
| Recombinant | Recombinant |
475
Invitrogen™ Human AKT2 (PKB beta), His Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | For research use only. Not for use in diagnostic procedures |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| Molecular Weight (g/mol) | 59.1 kDa |
| Formulation | 20 mM tris with 0.01% Triton X-100, 0.1 mM sodium orthovanadate, 0.5 mM EDTA, 150 mM NaCl, 20% glycerol, 2 mM DTT and no preservative; pH 7.5 |
| Sequence | Full length |
| Concentration | See Label |
| For Use With (Application) | Kinase Assay |
| Name | Human AKT2 (PKB beta), His Tag |
| Recombinant | Recombinant |
476
Invitrogen™ Human TEX264 (aa 107-184) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | PSPELIDLYQKFGFKVFSFPAPSHVVTATFPYTTILSIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPL |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human TEX264 (aa 107-184) Control Fragment |
| Recombinant | Recombinant |
477
Invitrogen™ Human CDK9/Cyclin T1, His Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Shipping Condition | Dry Ice |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| pH Range | 7.5 |
| Common Name | CDK9/Cyclin T1 |
| Molecular Weight (g/mol) | 46.9-84.8 kDa |
| KinaseFamily | CDK and CHK Kinase Family |
| Gene Symbol | CCNT1, CDK9 |
| Sequence | Full length |
| Storage Requirements | -80°C, Avoid Freeze/Thaw Cycles |
| Concentration | See Label |
| Expression System | Insect cells |
| For Use With (Application) | Kinase Assay |
| Protein Subtype | Serine/Threonine Kinases |
| Name | Human CDK9/Cyclin T1, His Tag |
| Accession Number | O60563, P50750 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Protein Form | Recombinant, Full Length |
| Product Type | Protein |
| Gene ID (Entrez) | 1025, 904 |
| Formulation | 50mM tris with 0.02% Triton X-100, 150mM NaCl, 0.5mM EDTA, 2mM DTT, 50% glycerol and no preservative; pH 7.5 |
| Protein Tag | His-tag |
| Species | Human |
| Recombinant | Recombinant |
478
Invitrogen™ Human CLK3, GST Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Shipping Condition | Dry Ice |
|---|---|
| Content And Storage | -80°C, Avoid Freeze/Thaw Cycles |
| Conjugate | Unconjugated |
| Form | Liquid |
| pH Range | 7.5 |
| Common Name | CLK3 |
| Molecular Weight (g/mol) | 86 kDa |
| KinaseFamily | CLK Kinase Family |
| Gene Symbol | CLK3 |
| Sequence | Full length |
| Storage Requirements | -80°C, Avoid Freeze/Thaw Cycles |
| Concentration | See Label |
| Expression System | Insect cells |
| For Use With (Application) | Kinase Assay |
| Name | Human CLK3, GST Tag |
| Accession Number | P49761 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | AI256811; CDC like kinase 3; cdc2/CDC28-like protein kinase 3; CDC-like kinase 3; Clk3; Dual specificity protein kinase CLK3; PHCLK3; PHCLK3/152; Protein kinase CLK3 |
| Product Type | Protein |
| Gene ID (Entrez) | 1198 |
| Formulation | 50mM tris with 150mM NaCl, 0.5mM EDTA, 2mM DTT, 0.02% Triton X-100, 50% glycerol and no preservative; pH 7.5 |
| Protein Tag | GST-tag |
| Recombinant | Recombinant |
479
Invitrogen™ Human FRK (PTK5), GST Tag Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | For research use only. Not for use in diagnostic procedures |
|---|---|
| Conjugate | Unconjugated |
| Form | Liquid |
| Molecular Weight (g/mol) | 86.3 kDa |
| Formulation | 50 mM tris HCl with 0.02% Triton X-100, 0.5 mM EDTA, 150 mM NaCl, 2 mM DTT, 50% glycerol and no preservative; pH 7.5 |
| Sequence | Full length |
| Concentration | See Label |
| For Use With (Application) | Kinase Assay |
| Name | Human FRK (PTK5), GST Tag |
| Recombinant | Recombinant |
480
Invitrogen™ Human Tartrate Resistant Acid Phosphatase (aa 217-290) Control Fragment Recombinant Protein
Recombinant Protein
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | THCLVKQLRPLLATYGVTAYLCGHDHNLQYLQDENGVGYVLSGAGNFMDPSKRHQRKVPNGYLRFHYGTEDSLG |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human Tartrate Resistant Acid Phosphatase (aa 217-290) Control Fragment |
| Recombinant | Recombinant |